PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00015455-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family LBD
Protein Properties Length: 233aa    MW: 25347.1 Da    PI: 7.2418
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00015455-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601346e-42741731100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+C ++Cvlapyfp ++p kf ++h++FGasn++k+l+++pe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+
  WALNUT_00015455-RA  74 PCAACKILRRRCGEKCVLAPYFPPTHPLKFTIAHRVFGASNIIKFLQEIPESQRADAVSSMVYEANARIRDPVYGCAGAICQLQKQVSELQ 164
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         a+la++++e
  WALNUT_00015455-RA 165 AQLAKAQAE 173
                         *****9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.81373174IPR004883Lateral organ boundaries, LOB
PfamPF031952.8E-4274171IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MEYKGKAMTP QPTPITVSPP FSSSPSSSLS PPQSSPSLSP PSKSSPFFPS SSVQHFSSPN  60
TEIPPSPPPV VLSPCAACKI LRRRCGEKCV LAPYFPPTHP LKFTIAHRVF GASNIIKFLQ  120
EIPESQRADA VSSMVYEANA RIRDPVYGCA GAICQLQKQV SELQAQLAKA QAELVNMQYQ  180
QANLVALICM EMTKSQECYN GVINEQLQVI PSVDTGSLLE DNNLALAWEP LWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011027000.14e-92PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR01e-76LBD1_ARATH; LOB domain-containing protein 1
TrEMBLI3T4513e-90I3T451_LOTJA; Uncharacterized protein
STRINGGLYMA20G31780.14e-88(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.19e-64LOB domain-containing protein 1